PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG680100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 29622.5 Da    PI: 9.2353
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG680100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.88.8e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtf+kRrng+lKKA+ELS+LCdae+a++ifss+g+lyeys+
  Pavir.5KG680100.1.p  9 KRIENTTNRQVTFCKRRNGLLKKAYELSILCDAEIALVIFSSRGRLYEYST 59
                         79***********************************************96 PP

2K-box104.21.7e-34831749100
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           + + +++ qqe+akL ++i++Lq++++hl+Ge++++++ keL+++e++Le+++ +iRskK+e+ll++ie++qk+e elq+en+ Lr+k+
  Pavir.5KG680100.1.p  83 IDVNSHQYFQQEAAKLHQQIQTLQNSNKHLMGESIGNMTAKELRSIESRLERGIGRIRSKKHEMLLAEIEYMQKREVELQNENMFLRAKV 172
                          566889***********************************************************************************9 PP

                K-box  99 ee 100
                          +e
  Pavir.5KG680100.1.p 173 AE 174
                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.894161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-32274IPR002100Transcription factor, MADS-box
CDDcd002656.24E-46275No hitNo description
PRINTSPR004042.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-323859IPR002100Transcription factor, MADS-box
PfamPF014865.4E-2785172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.8788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSILCD AEIALVIFSS RGRLYEYSTN  60
SVRSTIERYK KASASTSGTA PVIDVNSHQY FQQEAAKLHQ QIQTLQNSNK HLMGESIGNM  120
TAKELRSIES RLERGIGRIR SKKHEMLLAE IEYMQKREVE LQNENMFLRA KVAEAERAQQ  180
EAAEDQMTPP PDGAEATTTE LQALPPSLDP RGYYLQAAQA TMLAAASTAS SSSSSQHQQE  240
HHLQTALHLG YHIKVDSAAA SKGFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-21173173Myocyte-specific enhancer factor 2B
1tqe_R3e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-21173173Myocyte-specific enhancer factor 2B
1tqe_P3e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621100.0BT062110.1 Zea mays full-length cDNA clone ZM_BFb0215E12 mRNA, complete cds.
GenBankKJ7269310.0KJ726931.1 Zea mays clone pUT3477 MADS transcription factor (MADS41) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.11e-161PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.11e-161PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-132MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLK3XKX81e-160K3XKX8_SETIT; Uncharacterized protein
STRINGSi002551m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.12e-90MIKC_MADS family protein